PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 254aa    MW: 28406.7 Da    PI: 4.6257
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096574.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.22.5e-191967149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k+ie k+  qvtf+kRr g++ KA+ELSvLC+ae+a+++ s+  +++ +
  XP_011096574.1 19 KKIEKKTSLQVTFTKRRMGLFRKASELSVLCGAEIAILVKSPAERIFAF 67
                    68****************************************9988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-281170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.1331171IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-251282IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-181333IPR002100Transcription factor, MADS-box
PfamPF003192.9E-202067IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-183348IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-184869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDDDAAIKKT LGRRKIEIKK IEKKTSLQVT FTKRRMGLFR KASELSVLCG AEIAILVKSP  60
AERIFAFGHP SVETLIDRFQ RGIALSPETG TSSNGQTVGG EDGIRSKYEE SVRRLEMERR  120
VLKEKESSGG EGREFWFDEP LEGMELHELE EYVEALEELR DNVLRRVEEI EKRRPSALAT  180
TASSSNQLAN SLNQDDDQGF GFGFDFPAAG LPIEFNDQDF HGGIRSSVDE GLKVESADDD  240
HPLILDSTAS GYYI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096574.10.0PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A022RIX06e-51A0A022RIX0_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13821415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-24AGAMOUS-like 62